PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG026183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 361aa    MW: 40783.9 Da    PI: 7.0232
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG026183.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.5e-32224279156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH++Fv+a++qLGG ++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  CCG026183.1 224 KQRRCWSPELHRCFVDALQQLGGYQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 279
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.407221281IPR017930Myb domain
SuperFamilySSF466891.25E-17221280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-29223282IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-26224279IPR006447Myb domain, plants
PfamPF002493.8E-7226277IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MELSLDLGLF YVPKSISECL KEVSMVTDGS QKLPNPDDYV KRLEDERRKI DAFKRELPLC  60
MLLLNEAIIR LKEEAMQCKE LNALVPLKGG SNEDGNDKKK WMSSVQLWNT NNNINLDCKN  120
QDTRSEPKQR NEEDDDRSTC ENPIQFGNHG NKGGAFVPFK ALSGFERSKK KEEKEVVSQV  180
TGLSLMTPVP KSCDFMSKST NCGNQMKIQS KPQQQQQRQH AYRKQRRCWS PELHRCFVDA  240
LQQLGGYQVA TPKQIRELMQ VDGLTNDEVK SHLQKYRLHL LKVPASSATP GNDLWKSQDQ  300
CEDPVMHKIS ESDSPKAPLH GSSSAKATSN TGGDSMEAED DDKSESHSWN GVLHRPGEVH  360
V
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165992e-53AC216599.1 Populus trichocarpa clone POP051-K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011009272.10.0PREDICTED: uncharacterized protein LOC105114429
TrEMBLB9HE750.0B9HE75_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-68G2-like family protein